Impa2 Antibody - C-terminal region : FITC

Impa2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58230_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Impa2 can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Impa2 has been implicated as the pharmacological target for lithium Li+ action in brain.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Impa2

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol monophosphatase 2

Protein Size: 290

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58230_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58230_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 114663
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×