IMPA2 Antibody - middle region : FITC

IMPA2 Antibody - middle region : FITC
Artikelnummer
AVIARP58229_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IMPA2

Key Reference: Ohnishi,T., (2007) Neuropsychopharmacology 32 (8), 1727-1737

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol monophosphatase 2

Protein Size: 288

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58229_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58229_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3613
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×