IMPDH1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IMPDH1

Key Reference: Wang,J., (2008) Clin. Pharmacol. Ther. 83 (5), 711-717

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inosine-5'-monophosphate dehydrogenase 1

Protein Size: 563

Purification: Affinity Purified

• Artikelnummer: AVIARP54363_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54363_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 3614
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin