IMPDH2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IMPDH2

Molecular Weight: 56

Peptide Sequence: Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inosine-5'-monophosphate dehydrogenase 2

Protein Size: 514

Purification: Affinity Purified

• Artikelnummer: AVIARP54365_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54365_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 3615
• Wirt: Rabbit
• Konjugat: Conjugated, FITC