INPP1 Antibody - N-terminal region : Biotin

INPP1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54666_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: inositol polyphosphate 1-phosphatase

Protein Size: 399

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54666_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54666_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3628
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×