INSIG1 antibody - middle region (ARP40159_P050)

Description of Target: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane prote

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INSIG1

Key Reference: Roth,A., (2008) Mol. Pharmacol. 73 (4), 1282-1289

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Insulin induced gene 1 EMBL EAL23728.1

Protein Size: 330

Purification: Affinity Purified

• Artikelnummer: AVIARP40159-P050
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP40159_P050
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 3638
• Wirt: Rabbit
• Konjugat: Unconjugated