Interferon gamma Receptor 1 antibody

Interferon gamma Receptor 1 antibody
Artikelnummer
GTX02780-100
Verpackungseinheit
100 μg
Hersteller
GeneTex

Verfügbarkeit: wird geladen...
Preis wird geladen...
Application Note: WB: 0.1-0.5μg/ml. ICC/IF: 0.5-1μg/ml. IHC-Fr: 0.5-1μg/ml. FACS: 1-3μg/1x10⁶ cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 54

Form: Liquid

Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. [provided by RefSeq, Jul 2008]

Uniprot ID: P15260

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: interferon gamma receptor 1
Mehr Informationen
Artikelnummer GTX02780-100
Hersteller GeneTex
Hersteller Artikelnummer GTX02780-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Immunofluorescence, Immunohistochemistry (frozen), Western Blotting, Flow Cytometry, Immunocytochemistry
Isotyp IgG
Human Gene ID 3459
Wirt Rabbit
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF)
×