IQCE Antibody - middle region : Biotin

IQCE Antibody - middle region : Biotin
Artikelnummer
AVIARP55486_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IQCE

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: IQ domain-containing protein E

Protein Size: 695

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55486_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55486_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23288
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×