IQCE Antibody - middle region : HRP

IQCE Antibody - middle region : HRP
Artikelnummer
AVIARP55486_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IQCE

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: IQ domain-containing protein E

Protein Size: 695

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55486_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55486_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23288
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×