Irf2bp1 Antibody - N-terminal region : FITC

Irf2bp1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55314_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon regulatory factor 2 binding protein 1 (Predicted) EMBL EDM08246.1

Protein Size: 584

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55314_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55314_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 308404
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×