ISCA2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ISCA2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Iron-sulfur cluster assembly 2 homolog, mitochondrial

Protein Size: 154

Purification: Affinity Purified

• Artikelnummer: AVIARP53448_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53448_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 122961
• Wirt: Rabbit
• Konjugat: Conjugated, FITC