ITPK1 Antibody - N-terminal region : Biotin

ITPK1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54993_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ITPK1

Key Reference: Chamberlain,P.P., (2007) J. Biol. Chem. 282 (38), 28117-28125

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol-tetrakisphosphate 1-kinase

Protein Size: 414

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54993_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54993_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3705
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×