JMJD5 Antibody - middle region : HRP

JMJD5 Antibody - middle region : HRP
Artikelnummer
AVIARP58120_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: JMJD5 is a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor.JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD5

Key Reference: Imataka,H., (2007) Nat. Rev. Genet. 8 (11), 829-833

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lysine-specific demethylase 8

Protein Size: 416

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58120_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58120_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 79831
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×