JMJD8 Antibody - middle region : Biotin

JMJD8 Antibody - middle region : Biotin
Artikelnummer
AVIARP58212_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The functions of LOC339123 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC339123

Key Reference: Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: JmjC domain-containing protein 8

Protein Size: 285

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58212_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58212_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 339123
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×