JMJD8 Antibody - middle region : HRP

JMJD8 Antibody - middle region : HRP
Artikelnummer
AVIARP58212_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The functions of LOC339123 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC339123

Key Reference: Daniels,R.J., (2001) Hum. Mol. Genet. 10 (4), 339-352

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: SFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: JmjC domain-containing protein 8

Protein Size: 285

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58212_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58212_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 339123
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×