KCTD21 Antibody - middle region : HRP

KCTD21 Antibody - middle region : HRP
Artikelnummer
AVIARP54467_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCTD21

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: BTB/POZ domain-containing protein KCTD21

Protein Size: 260

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54467_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54467_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283219
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×