KCTD21 Antibody - N-terminal region : Biotin

KCTD21 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54466_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD21

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BTB/POZ domain-containing protein KCTD21

Protein Size: 260

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54466_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54466_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283219
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×