KDM7A Antibody - C region : FITC

KDM7A Antibody - C region : FITC
Artikelnummer
AVIARP58206_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human JHDM1D

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: CGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: lysine-specific demethylase 7A

Protein Size: 941

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58206_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58206_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 80853
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×