KHDC4 Antibody - middle region : FITC

KHDC4 Antibody - middle region : FITC
Artikelnummer
AVIARP55116_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0907

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: KH homology domain-containing protein 4

Protein Size: 614

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55116_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55116_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22889
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×