KHDC4 Antibody - N-terminal region : Biotin

KHDC4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55115_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human K0907

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTREL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: KH homology domain-containing protein 4

Protein Size: 614

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP55115_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55115_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22889
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×