KIAA0892 Antibody - middle region : FITC

KIAA0892 Antibody - middle region : FITC
Artikelnummer
AVIARP55232_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0892

Key Reference: Seitan,V.C., PLoS Biol. 4 (8), E242 (2006)

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAU2 chromatid cohesion factor homolog

Protein Size: 613

Purification: Affinity Purified

Subunit: SCC4 homolog
Mehr Informationen
Artikelnummer AVIARP55232_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55232_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23383
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×