KIAA0930 Antibody - C-terminal region : HRP

KIAA0930 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55214_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930

Key Reference: N/A

Molecular Weight: 40 kDa

Peptide Sequence: Synthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein KIAA0930

Protein Size: 370

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP55214_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55214_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23313
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×