KIAA0999 Antibody - middle region : Biotin

KIAA0999 Antibody - middle region : Biotin
Artikelnummer
AVIARP53784_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of KIAA0999 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0999

Molecular Weight: 139kDa

Peptide Sequence: Synthetic peptide located within the following region: LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase SIK3

Protein Size: 1263

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53784_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53784_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23387
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×