KIAA0999 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of KIAA0999 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0999

Molecular Weight: 139kDa

Peptide Sequence: Synthetic peptide located within the following region: LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase SIK3

Protein Size: 1263

Purification: Affinity Purified

• Artikelnummer: AVIARP53784_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53784_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23387
• Wirt: Rabbit
• Konjugat: Conjugated, HRP