KIAA1189 Antibody - middle region : HRP

KIAA1189 Antibody - middle region : HRP
Artikelnummer
AVIARP56188_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1189

Key Reference: Brockschnieder,D., (2006) J. Neurosci. 26 (3), 757-762

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ermin

Protein Size: 297

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56188_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56188_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57471
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×