KIAA1191 Antibody - middle region : FITC

KIAA1191 Antibody - middle region : FITC
Artikelnummer
AVIARP56290_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1191

Key Reference: Zuhlke,C., (1999) DNA Seq. 10 (1), 1-6

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative monooxygenase p33MONOX

Protein Size: 305

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56290_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56290_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57179
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×