KIF17 Antibody - middle region : HRP

KIF17 Antibody - middle region : HRP
Artikelnummer
AVIARP57461_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse KIF17

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: TGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: kinesin-like protein KIF17

Protein Size: 511

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57461_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57461_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57576
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×