Klf15 Antibody - N-terminal region : Biotin

Klf15 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58002_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Klf15

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Krueppel-like factor 15

Protein Size: 415

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58002_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58002_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 66277
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×