KLF8 Antibody - N-terminal region : FITC

KLF8 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57952_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8

Key Reference: Wang,X., (2007) Cancer Res. 67 (15), 7184-7193

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Krueppel-like factor 8

Protein Size: 359

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57952_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57952_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11279
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×