KLF8 Antibody - N-terminal region : HRP

KLF8 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57952_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8

Key Reference: Wang,X., (2007) Cancer Res. 67 (15), 7184-7193

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Krueppel-like factor 8

Protein Size: 359

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57952_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57952_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11279
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×