KLHDC2 Antibody - C-terminal region : FITC

KLHDC2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55016_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KLDC2

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: kelch domain-containing protein 2

Protein Size: 406

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55016_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55016_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23588
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×