KLHDC4 Antibody - N-terminal region : FITC

KLHDC4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56977_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLHDC4

Key Reference: Segade,F., (2007) Int. J. Biochem. Cell Biol. 39 (12), 2303-2313

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch domain-containing protein 4

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56977_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56977_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54758
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×