KLHL20 Antibody - C-terminal region : FITC

KLHL20 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55062_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the kelch family of proteins, which is characterized by a 44-56 amino acid repeat motif. The kelch motif appears in many different polypeptide contexts and contains multiple potential protein-protein contact sites. Members of this family are present both throughout the cell and extracellularly, with diverse activities.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KLHL20

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 20

Protein Size: 609

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55062_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55062_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27252
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×