KLHL7 Antibody - middle region : Biotin

KLHL7 Antibody - middle region : Biotin
Artikelnummer
AVIARP56234_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL7

Key Reference: Bredholt,G., (2006) Scand. J. Immunol. 64 (3), 325-335

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 7

Protein Size: 564

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56234_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56234_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55975
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×