KLHL7 Antibody - middle region : HRP

KLHL7 Antibody - middle region : HRP
Artikelnummer
AVIARP56234_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLHL7

Key Reference: Bredholt,G., (2006) Scand. J. Immunol. 64 (3), 325-335

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kelch-like protein 7

Protein Size: 564

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56234_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56234_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55975
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×