KLK7 Antibody - middle region : FITC

KLK7 Antibody - middle region : FITC
Artikelnummer
AVIARP57735_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KLK7

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: IKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kallikrein-7

Protein Size: 181

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57735_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57735_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5650
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×