Klkbl4 Antibody - C-terminal region : FITC

Klkbl4 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54527_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Klkbl4 is a secreted protein. Klkbl4 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Klkbl4

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inactive serine protease 54

Protein Size: 395

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54527_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54527_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221191
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×