KNG1 Antibody - N-terminal region : HRP (ARP59203_P050-HRP)

Epitope: Wet Ice

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kininogen-1 Ensembl ENSP00000396025

Protein Size: 391

Purification: Affinity Purified

• Artikelnummer: AVIARP59203_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59203_P050-HRP
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3827
• Wirt: Rabbit
• Konjugat: Conjugated, HRP