Kras Antibody - N-terminal region : FITC

Kras Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55409_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Kras is a oncogene and member of the small GTPase superfamily.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog EMBL AAI26087.1

Protein Size: 188

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55409_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55409_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24525
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×