Kras Antibody - N-terminal region : HRP

Kras Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55409_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Kras is a oncogene and member of the small GTPase superfamily.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog EMBL AAI26087.1

Protein Size: 188

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55409_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55409_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24525
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×