KRT84 Antibody - middle region : FITC

KRT84 Antibody - middle region : FITC
Artikelnummer
AVIARP55404_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT84

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Keratin, type II cuticular Hb4

Protein Size: 600

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55404_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55404_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3890
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×