KRT84 Antibody - middle region : HRP

KRT84 Antibody - middle region : HRP
Artikelnummer
AVIARP55404_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT84

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Keratin, type II cuticular Hb4

Protein Size: 600

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55404_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55404_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3890
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×