LACTB2 Antibody - middle region : Biotin

LACTB2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56810_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of LACTB2 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LACTB2

Key Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beta-lactamase-like protein 2

Protein Size: 288

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56810_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56810_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51110
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×