LANCL2 Antibody - middle region : Biotin

LANCL2 Antibody - middle region : Biotin
Artikelnummer
AVIARP57286_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LANCL2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LanC-like protein 2

Protein Size: 450

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57286_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57286_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55915
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×