LANCL3 Antibody - C-terminal region : HRP

LANCL3 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55888_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of LANCL3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LANCL3

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LanC-like protein 3

Protein Size: 388

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55888_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55888_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 347404
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×