Lap3 Antibody - N-terminal region : HRP

Lap3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56770_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lap3 is presumably involved in the processing and regular turnover of intracellular proteins. It catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytosol aminopeptidase

Protein Size: 519

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56770_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56770_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 66988
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×