LAT2 Antibody

Uniprot: Q9GZY6

Gene Name: LAT2

Immunogen: Recombinant human LAT2

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 43%

Core Sequence: WGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMGQLQREASPGP

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 43%, Rat - 46%, Pig - 47%, Cynomolgus monkey - 88%

Alternative gene names: LAB；NTAL；WBS15；WBSCR15；WBSCR5

Alternative protein names: Linker for activation of T-cells family member 2; Linker for activation of B-cells; Membrane-associated adapter molecule; Non-T-cell activation linker; Williams-Beuren syndrome chromosomal region 15 protein; Williams-Beuren syndrome chromosomal region 5 protein

Protein name: Linker for activation of T cells family member 2

Clone No.: K52022_8E2

Antigen Species: Human

Target Name: LAT2

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: succeed

IP Dilution: 1:100

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-971

Cross reactivity: Not tested

• Artikelnummer: ASBKC-963-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-963-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunoprecipitation, Western Blotting, Immunohistochemistry, Immunocytochemistry
• Isotyp: IgG2b
• Human Gene ID: 7462
• Wirt: Mouse
• Konjugat: Unconjugated