LCN1 Antibody - middle region : FITC

LCN1 Antibody - middle region : FITC
Artikelnummer
AVIARP54685_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LCN1

Key Reference: Yusifov,T.N., (er) Mol. Vis. 14, 180-188 (2008)

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lipocalin-1

Protein Size: 176

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54685_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54685_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3933
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×