Ldha Antibody - middle region : HRP

Ldha Antibody - middle region : HRP
Artikelnummer
AVIARP53601_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ldha mRNA expression in fibroblasts increases in response to induction by epidermal growth factor or serum.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ldha

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: L-lactate dehydrogenase A chain

Protein Size: 332

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53601_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53601_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24533
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×