LDHAL6B Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHAL6B

Key Reference: Pioli,P.A., (2002) J. Biol. Chem. 277 (38), 35738-35745

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: L-lactate dehydrogenase A-like 6B

Protein Size: 381

Purification: Affinity Purified

• Artikelnummer: AVIARP53813_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53813_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 92483
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin